This website requires JavaScript.

Vintage Towncraft JCPenney sweater vest retro bicycle size Large

$40

Pay in 4 interest-free payments of $10 with Learn more

Size
L
Condition
Good
Color
BlueRed
Category
WomenSweatersCrew & Scoop Necks
Style Tags
darkacademiavintagefindsgrandpacore
Step back in time with this charming vintage sweater vest by Towncraft for JCPenney. Featuring a delightful, retro-inspired pattern of high-wheel bicycles, this piece is a perfect layering staple for a nostalgic, preppy, or quirky aesthetic. Condition: Excellent vintage condition. This sweater has been thoroughly cleaned and sanitized using an LG Styler to ensure it is fresh and ready to wear. Brand: Towncraft (JCPenney) Size: Large Features: Authentic vintage ILGWU union-made label, bold blue base with red and white bicycle motif, comfortable knit construction. Measurements (laid flat): Width (Pit to Pit): Approx. 18.5 inches Length: Approx. 23 inches Pair this with a crisp collared shirt and trousers for a classic look, or wear it on its own for a fun, vintage-inspired outfit!

Bundle and Save

Bundle 2+ Items And Instantly Save 10%

View Bundle
Add To Bundle

Trust & Shipping

  • Posh Protect (Included)

    Get a refund if your order never ships or is not as described.

  • Shipping

    $6.49

Comment
Is this listing inappropriate? Report Listing
Other Sweaters you may like
People Also Searched