Vintage Towncraft JCPenney sweater vest retro bicycle size Large
$40
Pay in 4 interest-free payments of $10 with Learn more
- Size
- L
- Condition
- Good
- Color
- BlueRed
- Category
- WomenSweatersCrew & Scoop Necks
- Brand
- Towncraft
- Style Tags
- darkacademiavintagefindsgrandpacore
Step back in time with this charming vintage sweater vest by Towncraft for JCPenney. Featuring a delightful, retro-inspired pattern of high-wheel bicycles, this piece is a perfect layering staple for a nostalgic, preppy, or quirky aesthetic.
Condition: Excellent vintage condition. This sweater has been thoroughly cleaned and sanitized using an LG Styler to ensure it is fresh and ready to wear.
Brand: Towncraft (JCPenney)
Size: Large
Features: Authentic vintage ILGWU union-made label, bold blue base with red and white bicycle motif, comfortable knit construction.
Measurements (laid flat):
Width (Pit to Pit): Approx. 18.5 inches
Length: Approx. 23 inches
Pair this with a crisp collared shirt and trousers for a classic look, or wear it on its own for a fun, vintage-inspired outfit!
Like To Get Deals!


Trust & Shipping
Posh Protect (Included)
Get a refund if your order never ships or is not as described.
Shipping
$6.49
Other Sweaters you may like
People Also Searched
Trending Now
Account is under Review
Comment posting is temporarily restricted. Our team will reach out to you shortly. To understand why, select
Learn More.
Still Selling This?
Yes, this item is still for sale.
I don’t want to sell this item right now.
I no longer have this item.
Delete Listing?
This action cannot be undone. You will no longer see this listing in your closet and your account will not be affected.







































Comments